S100P_HUMAN P25815
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25815
Recommended name：Protein S100-P
EC number：
Alternative names：(Migration-inducing gene 9 protein) (MIG9) (Protein S100-E) (S100 calcium-binding protein P)
Cleaved into：
GeneID：6286
Gene names (primary )：S100P
Gene names (synonym )：S100E
Gene names (ORF )：
Length：95
Mass：10400
Sequence：MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Tissue specificity：Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias. {ECO:0000269|PubMed:14672411, ECO:0000269|PubMed:15632002}.
Induction：
Developmental stage：
Protein families：S-100 family