DQB1_HUMAN   P01920


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01920

Recommended name:HLA class II histocompatibility antigen, DQ beta 1 chain

EC number:

Alternative names:(MHC class II antigen DQB1)

Cleaved into:

GeneID:3119

Gene names  (primary ):HLA-DQB1

Gene names  (synonym ):HLA-DQB

Gene names  (ORF ):

Length:261

Mass:29991

Sequence:MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH

Tissue specificity:

Induction:

Developmental stage:

Protein families:MHC class II family


   💬 WhatsApp