KI3S1_HUMAN Q14943
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14943
Recommended name：Killer cell immunoglobulin-like receptor 3DS1
EC number：
Alternative names：(MHC class I NK cell receptor) (Natural killer-associated transcript 10) (NKAT-10)
Cleaved into：
GeneID：3813
Gene names (primary )：KIR3DS1
Gene names (synonym )：NKAT10
Gene names (ORF )：
Length：382
Mass：42475
Sequence：MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHREWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK
Tissue specificity：Expressed in NK and T-cell lines but not in B-lymphoblastoid cell lines or in a colon carcinoma cell line.
Induction：
Developmental stage：
Protein families：Immunoglobulin superfamily