MAT2B_HUMAN   Q9NZL9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NZL9

Recommended name:Methionine adenosyltransferase 2 subunit beta

EC number:

Alternative names:(Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase)

Cleaved into:

GeneID:27430

Gene names  (primary ):MAT2B

Gene names  (synonym ):TGR

Gene names  (ORF ):MSTP045 Nbla02999 UNQ2435/PRO4995

Length:334

Mass:37552

Sequence:MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:10644686, ECO:0000269|PubMed:11337507}.

Induction:

Developmental stage:

Protein families:DTDP-4-dehydrorhamnose reductase family, MAT2B subfamily


   💬 WhatsApp