MED30_HUMAN Q96HR3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96HR3
Recommended name:Mediator of RNA polymerase II transcription subunit 30
EC number:
Alternative names:(Mediator complex subunit 30) (TRAP/Mediator complex component TRAP25) (Thyroid hormone receptor-associated protein 6) (Thyroid hormone receptor-associated protein complex 25 kDa component) (Trap25)
Cleaved into:
GeneID:90390
Gene names (primary ):MED30
Gene names (synonym ):THRAP6 TRAP25
Gene names (ORF ):
Length:178
Mass:20277
Sequence:MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Tissue specificity:Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:11909976}.
Induction:
Developmental stage:
Protein families:Mediator complex subunit 30 family