MED11_HUMAN   Q9P086


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P086

Recommended name:Mediator of RNA polymerase II transcription subunit 11

EC number:

Alternative names:(Mediator complex subunit 11)

Cleaved into:

GeneID:400569

Gene names  (primary ):MED11

Gene names  (synonym ):

Gene names  (ORF ):HSPC296

Length:117

Mass:13129

Sequence:MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mediator complex subunit 11 family


   💬 WhatsApp