TM243_HUMAN   Q9BU79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BU79

Recommended name:Transmembrane protein 243

EC number:

Alternative names:(MDR1- and mitochondrial taxol resistance-associated protein) (MM-TRAG)

Cleaved into:

GeneID:79161

Gene names  (primary ):TMEM243

Gene names  (synonym ):C7orf23

Gene names  (ORF ):

Length:118

Mass:13391

Sequence:MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:15556294}.

Induction:

Developmental stage:

Protein families:TMEM243 family


   💬 WhatsApp