MBL2_HUMAN   P11226


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11226

Recommended name:Mannose-binding protein C

EC number:

Alternative names:(MBP-C) (Collectin-1) (MBP1) (Mannan-binding protein) (Mannose-binding lectin)

Cleaved into:

GeneID:4153

Gene names  (primary ):MBL2

Gene names  (synonym ):COLEC1 MBL

Gene names  (ORF ):

Length:248

Mass:26144

Sequence:MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Tissue specificity:Plasma protein produced mainly in the liver. {ECO:0000269|PubMed:18006063}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp