CMC4_HUMAN   P56277


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56277

Recommended name:Cx9C motif-containing protein 4

EC number:

Alternative names:(Mature T-cell proliferation 1 neighbor protein) (Mature T-cell proliferation-1 type A) (MTCP-1 type A) (Protein p8 MTCP-1) (p8MTCP1)

Cleaved into:

GeneID:100272147

Gene names  (primary ):CMC4

Gene names  (synonym ):C6.1B MTCP1 MTCP1NB

Gene names  (ORF ):

Length:68

Mass:7747

Sequence:MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

Tissue specificity:Expressed in many tissues with a relatively high level in skeletal muscle.

Induction:

Developmental stage:

Protein families:CMC4 family


   💬 WhatsApp