MRGRF_HUMAN   Q96AM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96AM1

Recommended name:Mas-related G-protein coupled receptor member F

EC number:

Alternative names:(Mas-related gene F protein) (G-protein coupled receptor 140) (G-protein coupled receptor 168)

Cleaved into:

GeneID:116535

Gene names  (primary ):MRGPRF

Gene names  (synonym ):GPR140 GPR168 MRGF

Gene names  (ORF ):PSEC0142

Length:343

Mass:38171

Sequence:MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family, Mas subfamily


   💬 WhatsApp