RTL8A_HUMAN   Q9BWD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BWD3

Recommended name:Retrotransposon Gag-like protein 8A

EC number:

Alternative names:(Mammalian retrotransposon derived protein 8A)

Cleaved into:

GeneID:26071

Gene names  (primary ):RTL8A

Gene names  (synonym ):CXX1B FAM127B MAR8A

Gene names  (ORF ):

Length:113

Mass:13188

Sequence:MDGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIRKESPLLNDYRGFLAEMKRVFGWEEDEDF

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM127 family


   💬 WhatsApp