ISK9_HUMAN Q5DT21
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5DT21
Recommended name：Serine protease inhibitor Kazal-type 9
EC number：
Alternative names：(Lymphoepithelial Kazal-type-related inhibitor 2)
Cleaved into：
GeneID：643394
Gene names (primary )：SPINK9
Gene names (synonym )：LEKTI2
Gene names (ORF )：
Length：86
Mass：9756
Sequence：MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC
Tissue specificity：Skin. Highly expressed at sites of hyperkeratosis. Also detected in thymus, tonsils, testis, pancreas, liver, placenta and brain. Expressed at stratum granulosum and stratum corneum at palmar and plantar sites (at protein level). {ECO:0000269|PubMed:19190773, ECO:0000269|PubMed:19194479}.
Induction：
Developmental stage：
Protein families：