RAE1E_HUMAN Q8TD07
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TD07
Recommended name：Retinoic acid early transcript 1E
EC number：
Alternative names：(Lymphocyte effector toxicity activation ligand) (NKG2D ligand 4) (N2DL-4) (NKG2DL4) (RAE-1-like transcript 4) (UL16-binding protein 4)
Cleaved into：
GeneID：135250
Gene names (primary )：RAET1E
Gene names (synonym )：LETAL N2DL4 ULBP4
Gene names (ORF )：UNQ1867/PRO4303
Length：263
Mass：30122
Sequence：MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMGIVLICVWWQNGEWQAGLWPLRTS
Tissue specificity：Predominantly expressed in the skin, but also expressed in testis and trachea. Up-regulated in tumor cells of different origins. Expression progressively decreased after treatment of tumor cells with retinoic acid. {ECO:0000269|PubMed:12732206, ECO:0000269|PubMed:14508119}.
Induction：
Developmental stage：
Protein families：MHC class I family