LY6D_HUMAN   Q14210


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14210

Recommended name:Lymphocyte antigen 6D

EC number:

Alternative names:(Ly-6D) (E48 antigen)

Cleaved into:

GeneID:8581

Gene names  (primary ):LY6D

Gene names  (synonym ):E48

Gene names  (ORF ):

Length:128

Mass:13286

Sequence:MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

Tissue specificity:Expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp