HOP_HUMAN Q9BPY8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BPY8
Recommended name：Homeodomain-only protein
EC number：
Alternative names：(Lung cancer-associated Y protein) (Not expressed in choriocarcinoma protein 1) (Odd homeobox protein 1)
Cleaved into：
GeneID：84525
Gene names (primary )：HOPX
Gene names (synonym )：HOD HOP LAGY NECC1 OB1
Gene names (ORF )：
Length：73
Mass：8260
Sequence：MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
Tissue specificity：Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma. {ECO:0000269|PubMed:12573257, ECO:0000269|PubMed:12759545}.
Induction：
Developmental stage：
Protein families：