MED19_HUMAN   A0JLT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0JLT2

Recommended name:Mediator of RNA polymerase II transcription subunit 19

EC number:

Alternative names:(Lung cancer metastasis-related protein 1) (Mediator complex subunit 19)

Cleaved into:

GeneID:219541

Gene names  (primary ):MED19

Gene names  (synonym ):LCMR1

Gene names  (ORF ):

Length:244

Mass:26273

Sequence:MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mediator complex subunit 19 family


   💬 WhatsApp