LTC4S_HUMAN Q16873
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16873
Recommended name:Leukotriene C4 synthase
EC number:EC:4.4.1.20
Alternative names:(LTC4 synthase) (Glutathione S-transferase LTC4) (Leukotriene-C(4) synthase) (Leukotriene-C4 synthase)
Cleaved into:
GeneID:4056
Gene names (primary ):LTC4S
Gene names (synonym ):
Gene names (ORF ):
Length:150
Mass:16567
Sequence:MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
Tissue specificity:Detected in lung, platelets and the myelogenous leukemia cell line KG-1 (at protein level). LTC4S activity is present in eosinophils, basophils, mast cells, certain phagocytic mononuclear cells, endothelial cells, vascular smooth muscle cells and platelets. {ECO:0000269|PubMed:7599836}.
Induction:
Developmental stage:
Protein families:MAPEG family