LRAT1_HUMAN   Q96KN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KN4

Recommended name:Protein LRATD1

EC number:

Alternative names:(LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)

Cleaved into:

GeneID:151354

Gene names  (primary ):LRATD1

Gene names  (synonym ):FAM84A NSE1

Gene names  (ORF ):

Length:292

Mass:32491

Sequence:MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE

Tissue specificity:Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.

Induction:

Developmental stage:

Protein families:LRATD family


   💬 WhatsApp