ANR37_HUMAN   Q7Z713


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z713

Recommended name:Ankyrin repeat domain-containing protein 37

EC number:

Alternative names:(Low-density lipoprotein receptor-related protein 2-binding protein) (hLrp2bp)

Cleaved into:

GeneID:353322

Gene names  (primary ):ANKRD37

Gene names  (synonym ):LPR2BP

Gene names  (ORF ):

Length:158

Mass:16872

Sequence:MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC

Tissue specificity:Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells. {ECO:0000269|PubMed:15809689}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp