CJ142_HUMAN B7Z368
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B7Z368
Recommended name:Uncharacterized protein encoded by LINC02881
EC number:
Alternative names:(Long intergenic non-protein coding RNA 2881)
Cleaved into:
GeneID:
Gene names (primary ):LINC02881
Gene names (synonym ):C10orf142
Gene names (ORF ):
Length:130
Mass:13757
Sequence:MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF
Tissue specificity:
Induction:
Developmental stage:
Protein families: