CQ112_HUMAN   F2Z3M2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:F2Z3M2

Recommended name:Uncharacterized protein encoded by LINC02876

EC number:

Alternative names:(Long intergenic non-protein coding RNA 2876)

Cleaved into:

GeneID:

Gene names  (primary ):LINC02876

Gene names  (synonym ):C17orf112

Gene names  (ORF ):

Length:114

Mass:12668

Sequence:MYTSLKSTFVAFADGRGTTESMPSPPLANSNHESPVNQLGNMQNMRLGPSFILTGIFLGNGRTEASPFFTDEFALSKIFPEYKRNLFGKFQTNMAFSLELDPPSLLLSVVLFMF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp