PPAC_HUMAN P24666
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24666
Recommended name：Low molecular weight phosphotyrosine protein phosphatase
EC number：EC:3.1.3.48
Alternative names：(LMW-PTP) (LMW-PTPase) (Adipocyte acid phosphatase) (Low molecular weight cytosolic acid phosphatase) (Red cell acid phosphatase 1)
Cleaved into：
GeneID：52
Gene names (primary )：ACP1
Gene names (synonym )：
Gene names (ORF )：
Length：158
Mass：18042
Sequence：MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Tissue specificity：T-lymphocytes express only isoform 2. {ECO:0000269|PubMed:9038134}.
Induction：
Developmental stage：
Protein families：Low molecular weight phosphotyrosine protein phosphatase family