SG1D1_HUMAN O95968
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95968
Recommended name:Secretoglobin family 1D member 1
EC number:
Alternative names:(Lipophilin-A)
Cleaved into:
GeneID:10648
Gene names (primary ):SCGB1D1
Gene names (synonym ):LIPHA LPNA
Gene names (ORF ):
Length:90
Mass:9898
Sequence:MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAYEKRVLITKTLGKIAEKCDR
Tissue specificity:Expressed in lachrymal gland, thymus, kidney, testis, ovary and salivary gland.
Induction:
Developmental stage:
Protein families:Secretoglobin family, Lipophilin subfamily