LHPL2_HUMAN Q6ZUX7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6ZUX7
Recommended name：LHFPL tetraspan subfamily member 2 protein
EC number：
Alternative names：(Lipoma HMGIC fusion partner-like 2 protein)
Cleaved into：
GeneID：10184
Gene names (primary )：LHFPL2
Gene names (synonym )：KIAA0206
Gene names (ORF )：
Length：228
Mass：24486
Sequence：MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL
Tissue specificity：Expressed in all tissues and cell lines examined except brain and peripheral blood leukocytes. {ECO:0000269|PubMed:9039502}.
Induction：
Developmental stage：
Protein families：LHFP family