KLRF2_HUMAN   D3W0D1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3W0D1

Recommended name:Killer cell lectin-like receptor subfamily F member 2

EC number:

Alternative names:(Lectin-like receptor F2) (Activating coreceptor NKp65)

Cleaved into:

GeneID:100431172

Gene names  (primary ):KLRF2

Gene names  (synonym ):

Gene names  (ORF ):

Length:207

Mass:24008

Sequence:MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSSLSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLYVTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILTHNGTSGV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp