MESD_HUMAN   Q14696


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14696

Recommended name:LRP chaperone MESD

EC number:

Alternative names:(LDLR chaperone MESD) (Mesoderm development LRP chaperone MESD) (Mesoderm development candidate 2) (Mesoderm development protein) (Renal carcinoma antigen NY-REN-61)

Cleaved into:

GeneID:23184

Gene names  (primary ):MESD

Gene names  (synonym ):KIAA0081 MESDC2 MESDM

Gene names  (ORF ):UNQ1911/PRO4369

Length:234

Mass:26077

Sequence:MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL

Tissue specificity:

Induction:

Developmental stage:

Protein families:MESD family


   💬 WhatsApp