LDH6A_HUMAN   Q6ZMR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZMR3

Recommended name:L-lactate dehydrogenase A-like 6A

EC number:EC:1.1.1.27

Alternative names:(LDHA-like protein 6A)

Cleaved into:

GeneID:160287

Gene names  (primary ):LDHAL6A

Gene names  (synonym ):LDHL2

Gene names  (ORF ):

Length:332

Mass:36507

Sequence:MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYEMVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGITDLIKVKLTLEEEACLQKSAETLWEIQKELKL

Tissue specificity:Testis-specific. {ECO:0000269|PubMed:18351441}.

Induction:

Developmental stage:

Protein families:LDH/MDH superfamily, LDH family


   💬 WhatsApp