LIME1_HUMAN   Q9H400


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H400

Recommended name:Lck-interacting transmembrane adapter 1

EC number:

Alternative names:(Lck-interacting membrane protein) (Lck-interacting molecule)

Cleaved into:

GeneID:54923

Gene names  (primary ):LIME1

Gene names  (synonym ):LIME

Gene names  (ORF ):LP8067

Length:295

Mass:31288

Sequence:MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCSLSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAGLEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRDPGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSCPSLGRGWRPLPASLP

Tissue specificity:Expressed in peripheral blood lymphocytes, lymphoid tissues, and liver. Present in T-cells and plasma cells, and in various hematopoietic cell lines (at protein level). {ECO:0000269|PubMed:14610044, ECO:0000269|PubMed:14610046, ECO:0000269|PubMed:16160011}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp