RL26L_HUMAN   Q9UNX3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UNX3

Recommended name:60S ribosomal protein L26-like 1

EC number:

Alternative names:(Large ribosomal subunit protein uL24-like 1)

Cleaved into:

GeneID:51121

Gene names  (primary ):RPL26L1

Gene names  (synonym ):RPL26P1

Gene names  (ORF ):

Length:145

Mass:17256

Sequence:MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uL24 family


   💬 WhatsApp