RL12_HUMAN   P30050


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30050

Recommended name:60S ribosomal protein L12

EC number:

Alternative names:(Large ribosomal subunit protein uL11)

Cleaved into:

GeneID:6136

Gene names  (primary ):RPL12

Gene names  (synonym ):

Gene names  (ORF ):

Length:165

Mass:17819

Sequence:MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uL11 family


   💬 WhatsApp