RL36L_HUMAN   Q969Q0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969Q0

Recommended name:60S ribosomal protein L36a-like

EC number:

Alternative names:(Large ribosomal subunit protein eL42-like)

Cleaved into:

GeneID:6166

Gene names  (primary ):RPL36AL

Gene names  (synonym ):

Gene names  (ORF ):

Length:106

Mass:12469

Sequence:MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12490704}.

Induction:

Developmental stage:

Protein families:Eukaryotic ribosomal protein eL42 family


   💬 WhatsApp