RM53_HUMAN   Q96EL3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96EL3

Recommended name:39S ribosomal protein L53, mitochondrial

EC number:

Alternative names:(L53mt) (MRP-L53) (Mitochondrial large ribosomal subunit protein mL53)

Cleaved into:

GeneID:116540

Gene names  (primary ):MRPL53

Gene names  (synonym ):

Gene names  (ORF ):

Length:112

Mass:12107

Sequence:MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL53 family


   💬 WhatsApp