RM50_HUMAN   Q8N5N7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N5N7

Recommended name:39S ribosomal protein L50, mitochondrial

EC number:

Alternative names:(L50mt) (MRP-L50) (Mitochondrial large ribosomal subunit protein mL50)

Cleaved into:

GeneID:54534

Gene names  (primary ):MRPL50

Gene names  (synonym ):

Gene names  (ORF ):

Length:158

Mass:18325

Sequence:MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL50 family


   💬 WhatsApp