RM44_HUMAN   Q9H9J2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H9J2

Recommended name:39S ribosomal protein L44, mitochondrial

EC number:EC:3.1.26.-

Alternative names:(L44mt) (MRP-L44) (Mitochondrial large ribosomal subunit protein mL44)

Cleaved into:

GeneID:65080

Gene names  (primary ):MRPL44

Gene names  (synonym ):

Gene names  (ORF ):

Length:332

Mass:37535

Sequence:MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ribonuclease III family, Mitochondrion-specific ribosomal protein mL44 subfamily


   💬 WhatsApp