RM42_HUMAN   Q9Y6G3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y6G3

Recommended name:39S ribosomal protein L42, mitochondrial

EC number:

Alternative names:(L42mt) (MRP-L42) (39S ribosomal protein L31, mitochondrial) (L31mt) (MRP-L31) (Mitochondrial large ribosomal subunit protein mL42)

Cleaved into:

GeneID:28977

Gene names  (primary ):MRPL42

Gene names  (synonym ):MRPL31 MRPS32 RPML31

Gene names  (ORF ):HSPC204 PTD007

Length:142

Mass:16661

Sequence:MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mL42 family


   💬 WhatsApp