PSPHL_HUMAN   O15172


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15172

Recommended name:Putative phosphoserine phosphatase-like protein

EC number:

Alternative names:(L-3-phosphoserine-phosphatase homolog)

Cleaved into:

GeneID:

Gene names  (primary ):PSPHP1

Gene names  (synonym ):CO9 PSPHL

Gene names  (ORF ):

Length:72

Mass:7804

Sequence:MASASCSPGGALASPEPGRKILPRMISHSELRKLFYSADAVCFDVDSTVISEEGIGCFHWIWRKCDQATSQG

Tissue specificity:Highly expressed in FA (Fanconi's anemia) B-cells of complementation group A and Raji cells. Not expressed in B-cells of other FA complementation groups. {ECO:0000269|PubMed:9573387}.

Induction:

Developmental stage:

Protein families:HAD-like hydrolase superfamily, SerB family


   💬 WhatsApp