RM30_HUMAN Q8TCC3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TCC3
Recommended name：39S ribosomal protein L30, mitochondrial
EC number：
Alternative names：(L30mt) (MRP-L30) (39S ribosomal protein L28, mitochondrial) (L28mt) (MRP-L28) (Mitochondrial large ribosomal subunit protein uL30m)
Cleaved into：
GeneID：51263
Gene names (primary )：MRPL30
Gene names (synonym )：MRPL28 RPML28
Gene names (ORF )：HSPC249
Length：161
Mass：18546
Sequence：MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uL30 family