RM28_HUMAN Q13084
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13084
Recommended name：39S ribosomal protein L28, mitochondrial
EC number：
Alternative names：(L28mt) (MRP-L28) (Melanoma antigen p15) (Melanoma-associated antigen recognized by T-lymphocytes) (Mitochondrial large ribosomal subunit protein bL28m)
Cleaved into：
GeneID：10573
Gene names (primary )：MRPL28
Gene names (synonym )：MAAT1
Gene names (ORF )：
Length：256
Mass：30157
Sequence：MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Tissue specificity：Found in a variety of normal tissues including spleen, testes, thymus, liver, kidney, brain, adrenal, lung and retinal tissue.
Induction：
Developmental stage：
Protein families：Bacterial ribosomal protein bL28 family