RM22_HUMAN   Q9NWU5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NWU5

Recommended name:39S ribosomal protein L22, mitochondrial

EC number:

Alternative names:(L22mt) (MRP-L22) (39S ribosomal protein L25, mitochondrial) (L25mt) (MRP-L25) (Mitochondrial large ribosomal subunit protein uL22m)

Cleaved into:

GeneID:29093

Gene names  (primary ):MRPL22

Gene names  (synonym ):MRPL25 RPML25

Gene names  (ORF ):HSPC158

Length:206

Mass:23641

Sequence:MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uL22 family


   💬 WhatsApp