RM21_HUMAN   Q7Z2W9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z2W9

Recommended name:39S ribosomal protein L21, mitochondrial

EC number:

Alternative names:(L21mt) (MRP-L21) (Mitochondrial large ribosomal subunit protein bL21m)

Cleaved into:

GeneID:219927

Gene names  (primary ):MRPL21

Gene names  (synonym ):

Gene names  (ORF ):

Length:205

Mass:22815

Sequence:MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEIAPCLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Bacterial ribosomal protein bL21 family


   💬 WhatsApp