KRBX4_HUMAN   Q5JUW0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5JUW0

Recommended name:KRAB domain-containing protein 4

EC number:

Alternative names:(KRAB box domain-containing protein 4)

Cleaved into:

GeneID:55634

Gene names  (primary ):KRBOX4

Gene names  (synonym ):ZNF673

Gene names  (ORF ):

Length:171

Mass:20100

Sequence:MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCAGEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER

Tissue specificity:Expressed in brain, ovary, testis, prostate, tonsil, heart, bone marrow, colon, breast and kidney. {ECO:0000269|PubMed:11944989}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp