CIB2_HUMAN   O75838


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75838

Recommended name:Calcium and integrin-binding family member 2

EC number:

Alternative names:(Kinase-interacting protein 2) (KIP 2)

Cleaved into:

GeneID:10518

Gene names  (primary ):CIB2

Gene names  (synonym ):KIP2

Gene names  (ORF ):

Length:187

Mass:21644

Sequence:MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Tissue specificity:Widely expressed (PubMed:23023331). {ECO:0000269|PubMed:23023331}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp