OOEP_HUMAN   A6NGQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NGQ2

Recommended name:Oocyte-expressed protein homolog

EC number:

Alternative names:(KH homology domain-containing protein 2) (Oocyte- and embryo-specific protein 19) (hOEP19)

Cleaved into:

GeneID:441161

Gene names  (primary ):OOEP

Gene names  (synonym ):C6orf156 KHDC2 OEP19

Gene names  (ORF ):

Length:149

Mass:17170

Sequence:MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQDPVA

Tissue specificity:

Induction:

Developmental stage:

Protein families:KHDC1 family


   💬 WhatsApp