PERP_HUMAN   Q96FX8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96FX8

Recommended name:p53 apoptosis effector related to PMP-22

EC number:

Alternative names:(Keratinocyte-associated protein 1) (KCP-1) (P53-induced protein PIGPC1) (Transmembrane protein THW)

Cleaved into:

GeneID:64065

Gene names  (primary ):PERP

Gene names  (synonym ):KCP1 KRTCAP1 PIGPC1 THW

Gene names  (ORF ):

Length:193

Mass:21386

Sequence:MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

Tissue specificity:Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts. {ECO:0000269|PubMed:12752121}.

Induction:

Developmental stage:

Protein families:TMEM47 family


   💬 WhatsApp