KRA44_HUMAN   Q9BYR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BYR3

Recommended name:Keratin-associated protein 4-4

EC number:

Alternative names:(Keratin-associated protein 4-13) (Keratin-associated protein 4.13) (Keratin-associated protein 4.4) (Ultrahigh sulfur keratin-associated protein 4.13) (Ultrahigh sulfur keratin-associated protein 4.4)

Cleaved into:

GeneID:84616

Gene names  (primary ):KRTAP4-4

Gene names  (synonym ):KAP4.13 KAP4.4 KRTAP4-13 KRTAP4.13 KRTAP4.4

Gene names  (ORF ):

Length:166

Mass:18023

Sequence:MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTCCRTTCCRPSCCVSRCYRPHCGQSLCC

Tissue specificity:Expressed in the hair follicles. {ECO:0000269|PubMed:15955084}.

Induction:

Developmental stage:

Protein families:KRTAP type 4 family


   💬 WhatsApp