KRA58_HUMAN O75690
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75690
Recommended name：Keratin-associated protein 5-8
EC number：
Alternative names：(Keratin, ultra high-sulfur matrix protein B) (Keratin-associated protein 5.8) (UHS keratin B) (UHS KerB) (Ultrahigh sulfur keratin-associated protein 5.8)
Cleaved into：
GeneID：57830
Gene names (primary )：KRTAP5-8
Gene names (synonym )：KAP5.8 KRTAP5.8 UHSKB
Gene names (ORF )：
Length：187
Mass：17519
Sequence：MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCKI
Tissue specificity：Restricted to hair root, not detected in any other tissues. Expressed in cuticle layers of differentiating hair follicles. {ECO:0000269|PubMed:15144888}.
Induction：
Developmental stage：
Protein families：KRTAP type 5 family