KRA51_HUMAN   Q6L8H4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6L8H4

Recommended name:Keratin-associated protein 5-1

EC number:

Alternative names:(Keratin, cuticle, ultrahigh sulphur 1-like) (Keratin-associated protein 5.1) (Ultrahigh sulfur keratin-associated protein 5.1)

Cleaved into:

GeneID:387264

Gene names  (primary ):KRTAP5-1

Gene names  (synonym ):KAP5.1 KRN1L KRTAP5.1

Gene names  (ORF ):

Length:278

Mass:24194

Sequence:MGCCGCSGGCGSSCGGCGSGCGGCGSGCGGCGSGCGGSGSSCCVPVCCCKPVCCRVPTCSCSSCGKGGCGSSGGSKGGCGSCGGCKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSGCGGCGSSCCVPVCCCKPMCCCVPACSCSSCGKGGCGSCGCSKGACGSCGGSKGGCGSCGGCKGGCGSCGGSKGGCGSGCGGCGSGCGVPVCCCSCSSCGSCAGSKGGCGSSCSQCSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPVCCQCKI

Tissue specificity:Expressed in hair root but not in skin. Expressed also in lung, pancreas, ovary, testis. {ECO:0000269|PubMed:15144888}.

Induction:

Developmental stage:

Protein families:KRTAP type 5 family


   💬 WhatsApp