KCIP2_HUMAN Q9NS61
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NS61
Recommended name:Kv channel-interacting protein 2
EC number:
Alternative names:(KChIP2) (A-type potassium channel modulatory protein 2) (Cardiac voltage-gated potassium channel modulatory subunit) (Potassium channel-interacting protein 2)
Cleaved into:
GeneID:30819
Gene names (primary ):KCNIP2
Gene names (synonym ):KCHIP2
Gene names (ORF ):
Length:270
Mass:30907
Sequence:MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Tissue specificity:Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart. {ECO:0000269|PubMed:11263977, ECO:0000269|PubMed:11684073, ECO:0000269|PubMed:15356203}.
Induction:
Developmental stage:
Protein families:Recoverin family