KCTD6_HUMAN Q8NC69
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NC69
Recommended name：BTB/POZ domain-containing protein KCTD6
EC number：
Alternative names：(KCASH3 protein) (Potassium channel tetramerization domain-containing protein 6)
Cleaved into：
GeneID：200845
Gene names (primary )：KCTD6
Gene names (synonym )：
Gene names (ORF )：
Length：237
Mass：27610
Sequence：MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD
Tissue specificity：Highly expressed in cerebellum and brain. Expression is down-regulated in medulloblastoma. {ECO:0000269|PubMed:21472142}.
Induction：
Developmental stage：
Protein families：