KCD21_HUMAN Q4G0X4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4G0X4
Recommended name:BTB/POZ domain-containing protein KCTD21
EC number:
Alternative names:(KCASH2 protein) (Potassium channel tetramerization domain-containing protein 21)
Cleaved into:
GeneID:283219
Gene names (primary ):KCTD21
Gene names (synonym ):
Gene names (ORF ):
Length:260
Mass:29643
Sequence:MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR
Tissue specificity:Highly expressed in cerebellum and brain. Expression is down-regulated in medulloblastoma. {ECO:0000269|PubMed:21472142}.
Induction:
Developmental stage:
Protein families: